PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6BS_B2C9F123A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 146aa    MW: 16635.1 Da    PI: 10.2793
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6BS_B2C9F123A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.6e-171562148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
  Traes_6BS_B2C9F123A.1 15 KGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 62
                           678*******************************************97 PP

2Myb_DNA-binding52.51.1e-1668113148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg +++eE++  +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  Traes_6BS_B2C9F123A.1  68 RGMFSQEEEDVVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 113
                            789*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.461062IPR017930Myb domain
SuperFamilySSF466891.17E-2912109IPR009057Homeodomain-like
SMARTSM007171.6E-111464IPR001005SANT/Myb domain
PfamPF002496.5E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-221669IPR009057Homeodomain-like
CDDcd001674.07E-101862No hitNo description
PROSITE profilePS5129425.29563117IPR017930Myb domain
SMARTSM007171.7E-1467115IPR001005SANT/Myb domain
PfamPF002497.2E-1568113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2570117IPR009057Homeodomain-like
CDDcd001672.21E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MGCRSCDKPK MNYRKGLWSP EEDQRLRDYI LKHGLGCWSA VPAKAGLQRN GKSCRLRWIN  60
YLRPGLKRGM FSQEEEDVVI NLQAKLGNKW SQIAMHLPGR TDNEVKNYWN SYLKKRVMQL  120
GSNSSSNPAS KNASPELLTS MSATTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-27911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686640.0AK368664.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077L03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573183.11e-90PREDICTED: myb-related protein 305-like
SwissprotQ9M0K41e-54LAF1_ARATH; Transcription factor LAF1
SwissprotQ8LPH62e-54MYB86_ARATH; Transcription factor MYB86
TrEMBLM7ZK351e-107M7ZK35_TRIUA; Transcription factor MYB86
TrEMBLW5H3P31e-107W5H3P3_WHEAT; Uncharacterized protein
TrEMBLW5GEG11e-106W5GEG1_WHEAT; Uncharacterized protein
STRINGMLOC_58869.11e-102(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.12e-55myb domain protein 18
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]